Yellow dots

Dinopoulet - Histoire

Les dinosaures n’auraient pas tous disparu ? Vraiment ?

Dernière mise à jour: avril 2022

Dinopoulet

Contexte

Une extinction de masse a eu lieu il y a environ 66 millions d’années, au printemps, causée par l’impact de l’astéroïde ‘Chicxulub impactor’ au Yucatan (Mexique).

Cet évènement a provoqué la disparition d’environ 75 % des espèces, dont les mollusques marins appelés ammonites et la plupart des dinosaures et des reptiles marins.

Mais les dinosaures n’ont pas tous disparu : certains ont survécu. Que sont devenus leurs descendants ?

Voici quelques éléments de réponse, basés sur des petits bouts de séquences de protéines retrouvées dans des os fossilisés de Brachylophosaurus canadensis et de Tyrannosaurus rex, deux espèces de dinosaures qui auraient disparu il y a respectivement quelque 80 et 68 millions d’années !

Podcast : C’est au printemps que les dinosaures ont été rayés de la Terre (RTS, mars 2022) – Source : The Mesozoic terminated in boreal spring (2022)

Une collection de fossiles

Les scientifiques collectent des informations sur les dinosaures et les espèces aujourd’hui disparues grâce aux différents fossiles retrouvés un peu partout sur notre planète : ils récupèrent ainsi des données morphologiques et parfois même des données moléculaires (ADN ou protéine), qu’ils peuvent comparer afin de déterminer les liens de parenté.

C'est quoi un fossile ?

Les fossiles sont des traces plus ou moins minéralisées d’anciens organismes vivants : cela peut être des os, des dents, des œufs, des traces de leur activité passée (emprunte, coprolithe, …) ou des moulages, conservés dans une roche sédimentaire.

Et certains de ces fossiles contiennent encore de l’ADN ou des protéines !

Quelques dates clés

Voici un petit récapitulatif pour mieux s’y retrouver dans l’histoire de la vie, des dinosaures … et des plus vieux fossiles :

4’500 millions d’années

Lâge de la Terre, et celui du système solaire, est estimé à 4’500 millions d’années, avec une incertitude de quelques dizaines de millions d’années.

 

Source: Comment a-t-on déterminé l’âge de la Terre ? (2021)

Print Friendly, PDF & Email

3’500 à 4’000 millions d’années

3’500 à 4’000 millions d’années

L’hypothétique ancêtre commun à toutes les espèces est appelé LUCA (Last Universal Common Ancestor). Il aurait vécu il y a 3’500 à 4’000 millions d’années et n’aurait été composé que d’une seule cellule.

 

Source: The physiology and habitat of the last universal common ancestor (2016) / Physiology, phylogeny, and LUCA (2016)

Print Friendly, PDF & Email

3’500 à 3’800 millions d’années

Parmi les fossiles les plus anciens, on retrouve ceux d’organismes unicellulaires qui auraient vécu il y a quelque 3’500 millions d’années. Des traces de leur présence ont été retrouvées en 1993 en Australie. D’autres traces de vie datant de 3’800 millions d’années ont été retrouvées au Québec en 2017.

 

Source: Evidence for early life in Earth’s oldest hydrothermal vent precipitates (2017) / SIMS analyses of the oldest known assemblage of microfossils document their taxon-correlated carbon isotope compositions (2017) / Metabolically diverse primordial microbial communities in Earth’s oldest seafloor-hydrothermal jasper (2022)

Print Friendly, PDF & Email

635 millions d’années

Fossile terrestre

Le plus vieux fossile terrestre a été retrouvé en Chine en 2021.  Il  s’agit d’une sorte de champignon qui aurait vécu il y a 635 millions d’années. (Image: Andrew Czaja of University of Cincinnati)

 

Source: Cryptic terrestrial fungus-like fossils of the early Ediacaran Period (2021)

Print Friendly, PDF & Email

425 millions d’années

Le fossile d’un « mille-pattes », Kampecaris obanensis, qui aurait vécu il y a 425 millions d’années, a été découvert sur une île écossaise.

Il s’agit du plus vieil animal terrestre connu et qui a aujourd’hui disparu.

 

Source: Myriapod divergence times differ between molecular clock and fossil evidence (2020)

Print Friendly, PDF & Email

150 millions d’années

150 millions d’années

En 1861, une plume fossile d’un peu moins de 7 cm et vieille de 150 millions d’années, a été découverte dans des carrières à Solnhofen, en Allemagne. A qui appartenait-elle ?

 

Source: Detection of lost calamus challenges identity of isolated Archaeopteryx feather (2019)

Print Friendly, PDF & Email

80 millions d’années

Brachylophosaurus

Les plus vieux fragments de protéines retrouvés à ce jour sont dérivés du collagène de Brachylophosaurus canadensis. Cette espèce de dinosaure, qui aurait vécu il y a  80 millions d’années, a été découverte au Montana (USA) en 2009.

 

>Brachylophosaurus canadensis – collagène COL1A1 
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPK GVQGPPGPQGPRGLT GPIGPTGFPGAA

 

Source: Expansion for the Brachylophosaurus canadensis Collagen I Sequence and Additional Evidence of the Preservation of Cretaceous Protein (2017) / 80-Million-Year-Old Dinosaur Collagen Confirmed (2017)

Print Friendly, PDF & Email

68 millions d’années

T-Rex

Deux équipes ont réussi à identifier des fragments de collagène présents dans un fémur de Tyrannosaurus rex vieux de 68 millions d’années. Ce spécimen a été découvert en Californie. Les fragments de collagène ont été analysés une première fois en 2007.

 

Source: Protein sequences from mastodon and Tyrannosaurus rex revealed by mass spectrometry (2007) / Reanalysis of Tyrannosaurus rex Mass Spectra (2009)

Print Friendly, PDF & Email

66 millions d’années

Cinquième extinction de masse qui a conduit à la disparition d’environ 75 % des espèces, dont les mollusques marins appelés ammonites et la plupart des dinosaures et reptiles marins.

Source : Wikipedia

Print Friendly, PDF & Email

1,25 à 2,08 millions d’années

mammoth

Le plus vieil ADN jamais séquencé à ce jour a été prélevé sur trois molaires appartenant à 3 mammouths ayant vécu il y a 1,25 à 2,08 millions d’années. Ces molaires ont été retrouvées dans le nord-est de la Sibérie.

 

>DQ188829.2 Mammuthus primigenius, génome complet de la mitochondrie
GTTAATGTAGCTTAAAACAAAAGCAAGGTACTGAAAATACCTAGACGAGTATATCCAACTCCATAAACAACAAAGGTTTGGTCCCGGCCTTCTTATTGGTTACTAGGAAACTTATACATGCAAGTATCCGCCCGCCAGTGAATACGCCTTCTAAATCATCACTGATCAAAGAGAGCTGGCATCAAGCACACACCCCAAGTGTAGCTCATGACGTCTCGCCTAGCCACACCCCCACGGGAAACAGCAGTAGTAAATATTTAGCAATTAACAAAAGTTAGAC...

 

Source: Million-year-old DNA sheds light on the genomic history of mammoths (2021)

Print Friendly, PDF & Email

Des protéines ‘fossiles’ ?

Il est aujourd’hui possible de séquencer les protéines retrouvées dans des fossiles de coquille d’œuf, de dent, d’os, ou de tissus momifiés : c’est le domaine appelé en anglais ‘Deep Time Paleoproteomics’…Et les records commencent à s’accumuler car les protéines semblent mieux se conserver que l’ADN au fil du temps et les technologies sont de plus en plus performantes !

Source: Deep Time Paleoproteomics: Looking Forward (2022)

Séquencer une protéine ?

A l’image d’un collier de perle, une protéine est constituée d’une succession d’acides aminés liés les uns aux autres par des liaisons chimiques. Il existe 20 acides aminés différents, représentés par des lettres (G, E, N, I , A, L, …).

La spectométrie de masse est une technologie qui permet de séquencer les protéines, c’est-à-dire de connaître l’ordre dans lequel s’enchaînent les acides aminés.

Les protéines célèbres en paléontologie...

Les protéines étudiées par les scientifiques qui s’intéressent aux organismes disparus sont en particulier le collagène et le cytochrome.

Pourquoi ?

Le collagène est une des protéines les plus abondantes dans les os. C’est lui qui est le plus fréquemment retrouvé dans la matière organique présente dans les os fossilisés.

Voici la protéine collègne de différentes espèces et la protéine collagène d’espèces aujourd’hui disparues dans la banque de données UniProtKB.

L’information que l’on a sur certaines protéines provient également de l’ADN. Si on connaît une séquence ADN, on peut prédire la séquence de la protéine correspondante. L’ADN est retrouvé surtout dans le noyau des cellules eucaryotes, mais également dans des organelles comme les mitochondries ou les chloroplastes. Or l’ADN retrouvé dans les mitochondries se conserve mieux que l’ADN présent dans le noyau des cellules au cours du temps. La protéine cytochrome est une des protéines dont le gène se trouve dans l’ADN mitochondrial.

Voici par exemple l’ADN mitochondrial de l’homme de Neandertal et la séquence du cytochrome de l’homme de Neandertal ou encore, la séquence des cytochromes du Dodo  et du loup de Tasmanie.

Voici la liste des protéines provenant d’organismes aujourd’hui disparus dans la banque de données UniProtKB.

Voici des fragments de la protéine collagène retrouvée chez différentes espèces.

Tyrannosaurus rex

T-rex

GATGAPGIAGAPGFPGARGAPGPQGPSGAPGPKGSAGPPGATGFPGAAGRGVQGPPGPQGPR

Datation: 68 millions d’années

Gallus gallus (poulet)

gallus gallus (poulet)

GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGNSGEPGAPGNKGDTGAKGEPGPAGVQGP

Datation: 10’000 à 50’000 ans

Mammut americanum (Mammouth)

Mammouth

GANGAPGIAGAPGFPGARGPAGPQGPSGAPGPKGNSGEPGAPGSKGDAGAGIQGPPGPAGEE

Datation: 1,65 million d’années

Brachylophosaurus canadensis

Brachylophosaurus canadensis

GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGSAGPPGATGFPGAAGRGETGPAGPAGPP

Datation: 80 millions d’années

L’évolution du collagène

Pour définir les liens de parenté, les biologistes recherchent ce que les espèces ont en commun mais aussi ce qui les distingue.

La protéine collagène est présente entre autre dans les os de tous les vertébrés. Mais comme toutes les protéines, elle est un peu différente d’une espèce à l’autre. Ces différences sont une véritable mine d’or pour étudier l’évolution et les liens de parenté qui existent entre les différentes espèces.

Comment étudier les liens de parenté entre espèces?

On peut, par exemple, compter les différences entre les séquences de collagène provenant de ces différentes espèces, et estimer ainsi quelles espèces sont les plus proches.

Les séquences de collagène du Brachylophosaurus canadensis et du Gallus gallus (poulet) ont été alignées ci-dessous : la présence d’un * signifie que les acides aminés sont identiques à cette position.

Combien de différences ?

La démarche est un peu fastidieuse mais surtout, elle n’est pas tout-à-fait finie : certains changements de séquence ont plus d’impact biologiquement que d’autres. Un peu comme dans un texte : certaines fautes d’orthographes modifieront le sens, d’autres pas !

C’est la raison pour laquelle les programmes bioinformatiques qui comparent les séquences utilisent des ‘matrices de substitution’.

Une valeur est attribuée à chaque paire d’acides aminés (par exemple : A-A: 4; G-G: 0; A-R: – 1). L’addition de ces valeurs permet de calculer le score de l’alignement.

Pour les experts: un exemple de matrice de substitution

Les matrices de substitution permettent de calculer le score d’un alignement en attribuant une valeur à chaque ‘paire’ d’acides aminés. Il existe différentes matrices de substitution qui  ont été établies en étudiant l’évolution de plusieurs familles de protéines.

De façon générale, la valeur de substitution est basée sur le degré de similitude des deux acides aminés. S’ils sont très similaires (en termes de forme et de propriétés physicochimiques), la paire d’acides aminés est probable et donc recevra un score positif. Si les acides aminés sont très différents, la paire est improbable et recevra donc un score négatif. Un score de 0 correspond à une paire qu’on pourrait observer par chance.

Voici, par exemple, la matrice de substitution appelée BLOSUM62 :

Classification des dinosaures et des oiseaux : un exemple

L’arbre ci-dessous a été calculé en comparant les séquences de plusieurs protéines collagène provenant de plus de 30 espèces différentes. Il a été validé par des programmes statistiques complexes.

Image librement adaptée de Expansion for the Brachylophosaurus canadensis Collagen I Sequence and Additional Evidence of the Preservation of Cretaceous Protein (2017)

Ces analyses ont permis d’établir que les dinosaures sont apparentés aux oiseaux.

Ces résultats confirment les prédictions faites à partir des comparaisons anatomiques des squelettes. Il s’agit toutefois de la première preuve  moléculaire (génétique) du lien évolutif qui existe entre les oiseaux modernes et les dinosaures.

Les dinosaures n’ont donc pas tous disparu : un petit groupe a survécu et parmi eux, les dinosaures ‘aviaires’, les ancêtres des oiseaux.

Source: Est-ce que les poules descendent vraiment des dinosaures ? (2014)

Un autre arbre plus détaillé pour comprendre les liens de parenté entre les oiseaux et les dinosaures (Wikimedia).

Le mystère de la plume

En 1861, quelques mois après la parution de l’ouvrage de Charles Darwin L’Origine des espèces, une plume fossile d’un peu moins de 7 cm et vieille de 150 millions d’années, a été découverte dans des carrières à Solnhofen, en Allemagne. L’identification du propriétaire de la plume a longtemps fait l’objet de controverses. Selon les dernières études, elle aurait appartenu à un Archaeopteryx lithographica, un dinosaure à plumes.

Source: Detection of lost calamus challenges identity of isolated Archaeopteryx feather (2019)

Nous savons aujourd’hui qu’Archaeopteryx lithographica est plus apparenté aux oiseaux qu’aux autres dinosaures. La classification des dinosaures et des oiseaux reste toutefois encore controversée !

Il y a 150 millions d’années, Archaeopteryx lithographica appartenait à une espèce parmi d’autres, espèce sans aucune destinée programmée !

Archaeopteryx lithographica. Source: Wikipedia

Print Friendly, PDF & Email

What did you think?

Loading spinner