//show holiday modal during set period and only once Skip to main content
Yellow dots

Dinohähnchen - Geschichte

Sind nicht alle Dinosaurier verschwunden? Wirklich ?

Letzte Aktualisierung: April 2022
Paleogenomics

Dinohähnchen

Hintergrund

In einem Frühjahr vor etwa 66 Millionen Jahren verursachte der Einschlag des Asteroiden „Chicxulub Impactor“ in Yucatan (Mexiko) ein Massensterben.
Dieses Ereignis verursachte das Verschwinden von etwa 75 % aller Arten, darunter Meeresweichtiere, Ammoniten genannt, und die meisten Dinosaurier und Meeresreptilien.

Aber die Dinosaurier verschwanden nicht alle: einige überlebten. Was wurde aus ihren Nachkommen?

Hier sind einige Antworten, basierend auf kleinen Stücken von Proteinsequenzen, die in versteinerten Knochen von Brachylophosaurus canadensis und Tyrannosaurus rex gefunden wurden, zwei Arten von Dinosauriern, die vor etwa 80 bzw. 68 Millionen Jahren ausgestorben sind!

Podcast (FR): C’est au printemps que les dinosaures ont été rayés de la Terre (RTS, mars 2022) (FR) – Quelle: The Mesozoic terminated in boreal spring (2022)

Eine Sammlung von Fossilien

Wissenschaftler sammeln Informationen über Dinosaurier und andere Arten, die inzwischen ausgestorben sind, mit Hilfe von diversen Fossilien, die an den verschiedensten Orten auf unserem Planeten gefunden wurden. Sie erhalten so morphologische Daten und manchmal sogar molekulare Daten (DNA oder Protein), die sie vergleichen können, um den Grad der Verwandtschaft zu bestimmen.

Was ist ein Fossil?

Fossilien sind mehr oder weniger mineralisierte Spuren von Lebewesen, die vor sehr langer Zeit gelebt haben. Das können Knochen, Zähne, Eier, Spuren ihrer früheren Aktivitäten (Bohrgänge, Koprolithen usw.) oder in Sedimentgestein erhaltene Abgüsse sein. 

Und einige dieser Fossilien enthalten noch DNA oder Proteine! 

Einige Eckdaten 

Hier eine kleine Zusammenfassung zur besseren Orientierung in der Geschichte des Lebens, der Dinosaurier … und der ältesten Fossilien: 

4.500 Millionen Jahre

Das Alter der Erde und des Sonnensystems wird auf 4.500 Millionen Jahre geschätzt, mit einer Unsicherheit von einigen zehn Millionen Jahren.

Quelle: Comment a-t-on déterminé l’âge de la Terre ? (2021) (FR)

Print Friendly, PDF & Email

Vor 3.500 bis 4.000 Millionen Jahren

Vor 3.500 bis 4.000 Millionen Jahren

Der hypothetische gemeinsame Vorfahr aller Arten heißt LUCA (Last Universal Common Ancestor). Er lebte vermutlich vor 3.500 bis 4.000 Millionen Jahren und bestand aus einer einzelnen Zelle.

 

Quelle: The physiology and habitat of the last universal common ancestor (2016) / Physiology, phylogeny, and LUCA (2016)

Print Friendly, PDF & Email

Vor 3.500 bis 3.800 Millionen Jahren

Zu den ältesten Fossilien gehören Einzeller, die vor etwa 3.500 Millionen Jahren lebten. Spuren ihrer Anwesenheit wurden 1993 in Australien gefunden. Weitere Spuren von Lebewesen, die 3.800 Millionen Jahre zurückreichen, wurden 2017 in Quebec gefunden.

Quelle: Evidence for early life in Earth’s oldest hydrothermal vent precipitates (2017) / SIMS analyses of the oldest known assemblage of microfossils document their taxon-correlated carbon isotope compositions (2017) / Metabolically diverse primordial microbial communities in Earth’s oldest seafloor-hydrothermal jasper (2022) 

Print Friendly, PDF & Email

635 Millionen Jahre

Fossile terrestre

Das älteste Fossil eines Lebewesens, das auf festem Land lebte, wurde 2021 in China gefunden. Es handelt sich um eine Pilzart, die vor 635 Millionen Jahren lebte. (Bild: Andrew Czaja von der University of Cincinnati)

Quelle: Cryptic terrestrial fungus-like fossils of the early Ediacaran Period (2021)

Print Friendly, PDF & Email

425 Millionen Jahre

Auf einer schottischen Insel wurde das Fossil eines «Tausendfüsslers» entdeckt, Kampecaris obanensis, der vor 425 Millionen Jahren lebte.

Dieser «Tausendfüssler» ist das älteste bekannte Landtier und ist jetzt ausgestorben.

Quelle: Myriapod divergence times differ between molecular clock and fossil evidence (2020)

Print Friendly, PDF & Email

150 Millionen Jahre

150 Millionen Jahre

1861 wurde in den Steinbrüchen von Solnhofen (Deutschand) eine knapp 7 cm lange und 150 Millionen Jahre alte fossile Feder entdeckt. Wem gehörte sie?

Quelle: Detection of lost calamus challenges identity of isolated Archaeopteryx feather (2019)

Print Friendly, PDF & Email

80 Millionen Jahre

Brachylophosaurus

Die ältesten bisher gefundenen Proteinfragmente stammen aus Kollagen von Brachylophosaurus canadensis. Diese Dinosaurierart, die vor 80 Millionen Jahren lebte, wurde 2009 in Montana (USA) entdeckt.

 

>Brachylophosaurus canadensis – collagen COL1A1 
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPK GVQGPPGPQGPRGLT GPIGPTGFPGAA

 

Quelle: Expansion for the Brachylophosaurus canadensis Collagen I Sequence and Additional Evidence of the Preservation of Cretaceous Protein (2017) / 80-Million-Year-Old Dinosaur Collagen Confirmed (2017)

Print Friendly, PDF & Email

68 Millionen Jahre

T-Rex

Zwei Teams ist es gelungen, Kollagenfragmente aus einem 68 Millionen Jahre alten Oberschenkelknochen  zu identifizieren. Dieser Knochen stammte von einem Tyrannosaurus rex und wurde in Kalifornien entdeckt. Die Kollagenfragmente wurden erstmals 2007 analysiert.

Quelle: Protein sequences from mastodon and Tyrannosaurus rex revealed by mass spectrometry (2007) / Reanalysis of Tyrannosaurus rex Mass Spectra (2009)

Print Friendly, PDF & Email

66 Millionen Jahre

Fünftes Massensterben, das zum Verschwinden von etwa 75 % der Arten führte, darunter Meeresweichtiere namens Ammoniten und die meisten Dinosaurier und Meeresreptilien.

Quelle: Wikipedia

Print Friendly, PDF & Email

1,25 bis 2,08 Millionen Jahre

mammoth

Die älteste bisher sequenzierte DNA stammt von drei Backenzähnen von drei Mammuts, die vor 1,25 bis 2,08 Millionen Jahren lebten. Diese Backenzähne wurden im Nordosten Sibiriens gefunden.

>DQ1888299.2 Mammuthus primigenius mitochondrion, complete genome
GTTAATGTAGCTTAAAACAAAAGCAAGGTACTGAAAATACCTAGACGAGTATATCCAACTCCATAAACAACAAAGGTTTGGTCCCGGCCTTCTTATTGGTTACTAGGAAACTTATACATGCAAGTATCCGCCCGCCAGTGAATACGCCTTCTAAATCATCACTGATCAAAGAGAGCTGGCATCAAGCACACACCCCAAGTGTAGCTCATGACGTCTCGCCTAGCCACACCCCCACGGGAAACAGCAGTAGTAAATATTTAGCAATTAACAAAAGTTAGAC...

 

Quelle: Million-year-old DNA sheds light on the genomic history of mammoths (2021)

Print Friendly, PDF & Email

Fossilized proteins?

Heutzutage ist es möglich, Proteine aus fossilen Eierschalen, Zähnen, Knochen oder mumifizierten Geweben ​​zu sequenzieren: dieses Forschungsgebiet wird auf Englisch «Deep Time Paleoproteomics» genannt … Und es gibt immer mehr solche Funde, weil Proteine anscheinend dem Zahn der Zeit besser widerstehen​​ als DNA, und weil die Technologien immer effizienter werden.

Quelle: Deep Time Paleoproteomics: Looking Forward (2022)

Ein Protein sequenzieren?

Wie eine Perlenkette besteht ein Protein aus einer Abfolge von Aminosäuren, die durch chemische Bindungen miteinander verbunden sind. Es gibt 20 verschiedene Aminosäuren, dargestellt durch Buchstaben (G, E, N, I, A, L, …). 

Die Massenspektrometrie ist eine Technologie, die es ermöglicht, Proteine ​​zu sequenzieren, dh die Reihenfolge zu bestimmen, in der die Aminosäuren miteinander verknüpft sind. 

Berühmte Proteine in der Paläontologie...

Wissenschaftler, die sich für ausgestorbene Organismen interessieren, untersuchen insbesondere die Proteine ​​Kollagen und Cytochrom.
Warum?

Kollagen ist ein Protein, das in Knochen in grossen Mengen vorkommt. Es ist das Protein, das am häufigsten in der organischen Substanz versteinerter Knochen gefunden wird.

Hier ist das Kollagenprotein von verschiedenen Arten und das Kollagenprotein von jetzt ausgestorbenen Arten in der UniProtKB-Datenbank.

Die Informationen, die wir über bestimmte Proteine ​​haben, stammen ebenfalls von der DNA. Wenn wir eine DNA-Sequenz kennen, so können wir die Sequenz des entsprechenden Proteins vorhersagen. DNA findet sich hauptsächlich im Zellkern eukaryotischer Zellen, aber auch in Organellen wie Mitochondrien oder Chloroplasten. Die mitochondriale DNA bleibt jedoch im Laufe der Zeit besser erhalten als die DNA, die im Zellkern enthalten ist. Das Cytochrom-Protein ist eines der Proteine, dessen Gen in der mitochondrialen DNA enthalten ist. 

Hier ist zum Beispiel die mitochondriale DNA des Neandertalers und die Cytochromsequenz des Neandertalers, und zum Vergleich die Cytochromsequenz des Dodo und des Tasmanischen Wolfs.

Hier ist die Liste der Proteine ​​von jetzt ausgestorbenen Organismen in der UniProtKB-Datenbank.

Hier sind Fragmente des Kollagenproteins die in verschiedenen Arten gefunden wurden: 

Tyrannosaurus rex

T-rex

GATGAPGIAGAPGFPGARGAPGPQGPSGAPGPKGSAGPPGATGFPGAAGRGVQGPPGPQGPR

Datierung: 68 Millionen Jahre

Gallus gallus (Hähnchen)

gallus gallus (poulet)

GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGNSGEPGAPGNKGDTGAKGEPGPAGVQGP

    Datierung: vor 10.000 bis 50.000 Jahren

 

Mammut americanum (Mammut)

Mammouth

GANGAPGIAGAPGFPGARGPAGPQGPSGAPGPKGNSGEPGAPGSKGDAGAGIQGPPGPAGEE

Datierung: 1,65 Millionen Jahre

 

Brachylophosaurus canadensis

Brachylophosaurus canadensis

GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGSAGPPGATGFPGAAGRGETGPAGPAGPP

Datierung: 80 Millionen Jahre

 

Die Evolution des Kollagens 

Um den Grad der Verwandtschaft zu bestimmen, suchen Biologen danach, was Arten gemeinsam haben, aber auch, was sie unterscheidet. 

Das Protein Kollagen kommt unter anderem in den Knochen aller Wirbeltiere vor. Aber wie alle Proteine ​​ist es von Art zu Art ein wenig verschieden. Diese Unterschiede sind eine wahre Goldgrube für die Untersuchung der Evolution und der Verwandtschaftsbeziehungen, die zwischen den verschiedenen Arten bestehen. 

Wie untersucht man die Verwandtschaftsbeziehungen zwischen Arten?

Es ist beispielsweise möglich, die Unterschiede zwischen den Kollagensequenzen verschiedener Arten zu zählen, und somit abzuschätzen, welche Arten am nächsten verwandt sind.

Die Kollagensequenzen von Brachylophosaurus canadensis und Gallus gallus (Hähnchen) wurden untereinander aufgereiht. Das Vorhandensein eines * bedeutet, dass die Aminosäuren an dieser Position identisch sind.

Wie viele Unterschiede hat es?

 

Der Prozess ist etwas langwierig, aber vor allem geht es noch weiter: einige Sequenzänderungen haben mehr biologische Auswirkungen als andere. Ein bisschen wie in einem Text: manche Rechtschreibfehler ändern die Bedeutung, andere nicht! 

Aus diesem Grund verwenden Bioinformatik-Programme, die Sequenzen vergleichen, „Ersatzmatrizen“. 

Jedem Aminosäurepaar wird ein Wert zugeordnet (zB: A-A: 4; G-G: 0; A-R: – 1). Die Addition dieser Werte ermöglicht es, für jede paarweise Aufreihung zweier Sequenzen (ein sogenanntes Alignment) eine Punktzahl zu berechnen. 

Für Experten: Ein Beispiel für eine Substitutionsmatrix

Substitutionsmatrizen berechnen die Punktzahl eines Alignments, indem sie jedem „Paar“ von Aminosäuren einen Wert zuweisen. Es gibt verschiedene Substitutionsmatrizen, die durch die Untersuchung der Evolution mehrerer Proteinfamilien erarbeitet wurden. 

Im Allgemeinen basiert der Substitutionswert auf dem Ähnlichkeitsgrad der beiden Aminosäuren. Wenn sie sehr ähnlich sind (hinsichtlich ihrer Form und physikalisch-chemischen Eigenschaften), ist das Aminosäurepaar wahrscheinlich und wird daher positiv bewertet. Wenn die Aminosäuren sehr unterschiedlich sind, ist das Paar unwahrscheinlich und erhält daher eine negative Bewertung. Eine Punktzahl von 0 entspricht einem Paar, das zufällig vorkommen könnte. 

Hier ist zum Beispiel die Substitutionsmatrix namens BLOSUM62: 

Klassifizierung von Dinosauriern und Vögeln: ein Beispiel 

Der folgende Baum wurde berechnet, indem die Sequenzen mehrerer Kollagenproteine ​​​​von mehr als 30 verschiedenen Arten verglichen wurden. Er wurde durch komplexe statistische Programme validiert. 

Bild frei adaptiert von Expansion for the Brachylophosaurus canadensis Collagen I Sequence and Additional Evidence of the Preservation of Cretaceous Protein (2017)

Diese Ergebnisse bestätigen die Vorhersagen, die aus den anatomischen Vergleichen der Skelette gemacht wurden.

Es ist jedoch der erste molekulare (genetische) Beweis für die evolutionäre Verbindung zwischen modernen Vögeln und Dinosauriern. 

Die Dinosaurier verschwanden also nicht alle: Eine kleine Gruppe überlebte, darunter die „Vogel“-Dinosaurier, die Vorfahren der Vögel. 

Ein weiterer detaillierterer Baum, um die Verwandtschaft zwischen Vögeln und Dinosauriern zu verstehen  (wikimedia).

Das Geheimnis der Feder 

1861, wenige Monate nach der Veröffentlichung von Charles Darwins Buch The Origin of Species, wurde in den Steinbrüchen von Solnhofen (Deutschland) eine knapp 7 cm lange und 150 Millionen Jahre alte fossile Feder entdeckt. Die Identifizierung des Besitzers der Feder ist seit langem Gegenstand von Kontroversen. Neuesten Studien zufolge gehörte sie vermutlich einem Archaeopteryx lithographica, einem gefiederten Dinosaurier. 

Quelle: Detection of lost calamus challenges identity of isolated Archaeopteryx feather (2019)

Wir wissen heute, dass Archaeopteryx lithographica eher mit Vögeln als mit anderen Dinosauriern verwandt ist. Die Klassifizierung von Dinosauriern und Vögeln ist jedoch immer noch umstritten! 

Vor 150 Millionen Jahren gehörte Archaeopteryx lithographica zu einer Art unter vielen anderen, einer Art ohne vorprogrammiertes Schicksal!

Archaeopteryx lithographica Quelle: Wikipedia

Print Friendly, PDF & Email