//show holiday modal during set period and only once Skip to main content
Yellow dots

Dinohähnchen
– Jetzt sind Sie dran

Es liegt an Ihnen, herauszufinden, was aus den Nachkommen der Dinosaurier geworden ist!

Dauer der Aktivität: 30 Minuten
Altersempfehlung: ab 15 Jahren
Paleogenomics

Dinohähnchen

Hintergrung

Der Zweck dieser Aktivität ist es, die Daten und wissenschaftlichen Ansätze zu entdecken, die verwendet wurden, um die Verwandtschaftsbeziehungen zwischen Dinosauriern und Vögeln heute zu untersuchen. 

Aktivität 1

Um die Verwandtschaft zu definieren, suchen Biologen danach, was Arten gemeinsam haben, aber auch, was sie unterscheidet. Dazu nutzen sie morphologische Daten (zum Beispiel die Form der Knochen) oder molekulare Daten (DNA oder Protein).

Das Protein Kollagen kommt in den Knochen aller Wirbeltiere vor. Es wurde in versteinerten Knochen von Brachylophosaurus canadensis und Tyranosaurus rex gefunden, zwei Dinosaurierarten, die vor etwa 80 bzw. 68 Millionen Jahren verschwunden wären!

Wie alle Proteine unterscheidet sich auch das Kollagenprotein von Art zu Art ein wenig. Diese Unterschiede sind eine wahre Goldgrube für die Untersuchung der Evolution und der Verwandtschaftsbeziehungen, die zwischen den verschiedenen Arten bestehen.

Jetzt sind Sie dran

Hier ist die Aminosäuresequenz von Kollagen verschiedener Arten.

>Brachylophosaurus canadensis 
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGSAGPPGATGFPGAAGRGETGPAGPAGP 
>Tyranosaurus rex 
GATGAPGIAGAPGFPGARGAPGPQGPSGAPGPKGSAGPPGATGFPGAAGRGVQGPPGPQGP 
>Python bivittatus 
GSTGSPGIAGAPGFPGARGPAGPQGPSGAPGPKGNSGEPGAPGNKGDAGAGEPGPVGVQGP 
>Coturnix japonica (Japanese quail) 
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGNSGEPGAPGNKGDTGAGEPGPAGVQGP 
>Gallus gallus (Huhn) 
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGNSGEPGAPGNKGDTGAGEPGPAGVQGP 
>Alligator sinensis 
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGNSGEPGAQGNKGDTGAGVQGPPGPAGE

Achten Sie auf die Anzahl der Unterschiede zwischen der Kollagensequenz von Brachylophosaurus canadensis und der Kollagensequenz anderer Arten.

Sie können dies manuell tun oder das Computerprogramm SIM – Alignment Tool for protein sequences

Füllen Sie die Tabelle aus und überprüfen Sie Ihre Ergebnisse.

SpeziesAnzahl der Unterschiede
Brachylophosaurus canadensis0
Tyranosaurus rex
Python bivittatus
Coturnix japonica (Japanese quail)
Gallus gallus (Huhn)
Alligator sinensis

Prüfen

Ich gebe auf!

Aktivität 2

Der Prozess für Aktivität 1 ist etwas langwierig und noch nicht ganz abgeschlossen: Einige Änderungen haben biologisch mehr Auswirkungen als andere.

Aus diesem Grund verwenden Bioinformatikprogramme, die Sequenzen vergleichen, eine „Ersatzmatrix“, um den Alignment-Score zu berechnen, wie z. B. die BLOSUM62-Matrix. 

Diese Substitutionsmatrizen weisen jedem Aminosäurepaar einen Wert zu (zum Beispiel: A-A: 4; G-G: 0; A-R: – 1). Die Addition dieser Werte ermöglicht die Berechnung der Endnote des Alignments.

BLOSUM62

Im Allgemeinen basiert der Substitutionswert auf dem Ähnlichkeitsgrad der beiden Aminosäuren. Wenn sie sehr ähnlich sind (in Bezug auf Form und physikalisch-chemische Eigenschaften), erhält das Aminosäurepaar eine hohe Punktzahl. Wenn die Aminosäuren sehr unterschiedlich sind, erhält das Aminosäurepaar eine niedrige Punktzahl. 

Hier ist die Tabelle mit den unter Verwendung der BLOSUM62-Matrix berechneten Scores, die die Kollagensequenz von Brachylophosaurus canadensis mit der Kollagensequenz anderer Arten vergleicht.

Um diese 2 zu 2 Alignment- Punktzahl zu verifizieren, können Sie das Programm SIM – Alignment Tool for protein sequences verwenden. Abhängig von den gewählten Programmen und Einstellungen können die Ergebnisse unterschiedlich sein.

Spezies Anzahl der UnterschiedePunktzahl
Brachylophosaurus canadensis0340
Tyranosaurus rex6304
Python bivittatus15258
Coturnix japonica (Japanese quail)12267
Gallus gallus (Huhn)12267
Alligator sinensis13262

Jetzt sind Sie dran

Wer hat mit wem einen gemeinsamen Vorfahren?

Desto ähnlicher die Proteine zweier Arten sind, um so jünger ist ihr gemeinsamer Vorfahre. Ordnen Sie die verschiedenen Arten in Abhängigkeit von den in der obigen Tabelle enthaltenen Daten (Punktzahlen) dem Stammbaum unten zu.

Brachylophosaurus canadensis
Python bivittatus
Coturnix japonica (Japanese quail)
Alligator sinensis
Gallus gallus (Huhn)
Tyranosaurus rex
1
2
3
4
5
6

Durch diese Vorgehensweise und aufwändige statistische Analysen mit Kollagensequenzen von mehr als 30 verschiedenen Arten konnte festgestellt werden, dass Dinosaurier die nächsten Verwandten der Vögel sind.

Die Dinosaurier verschwanden also nicht alle: Eine kleine Gruppe überlebte, darunter die „Vogel“-Dinosaurier, die Vorfahren unserer Vögel.

Diese Ergebnisse bestätigen die Vorhersagen, die aus den anatomischen Vergleichen der Skelette gemacht wurden. Es ist jedoch der erste molekulare (genetische) Beweis für die evolutionäre Verbindung zwischen modernen Vögeln und Dinosauriern.

Print Friendly, PDF & Email