Skip to main content
Yellow dots

Dinopoulet
- A vous de jouer

A vous de découvrir ce que sont devenus les descendants des dinosaures !

Durée de l’activité : 30 minutes
Âge conseillé : dès 15  ans
Paleogenomics

Dinopoulet

Contexte

Le but de cette activité est de découvrir les données et les démarches scientifiques qui ont été utilisées pour étudier les liens de parenté entre les dinosaures et les oiseaux d’aujourd’hui.

Activité 1

Pour définir les liens de parenté, les biologistes recherchent ce que les espèces ont en commun mais aussi ce qui les distingue. Pour cela, ils utilisent des données morphologiques (la forme des os par exemple) ou des données moléculaires (ADN ou protéine).

La protéine collagène est présente dans les os de tous les vertébrés. Elle a été retrouvée dans des os fossilisés de Brachylophosaurus canadensis et de Tyranosaurus rex, 2 espèces de dinosaures qui auraient disparu il y a respectivement quelques 80 et 68 millions d’années !

Comme toutes les protéines, la protéine collagène est un peu différente d’une espèce à l’autre. Ces différences sont une véritable mine d’or pour étudier l’évolution et les liens de parenté qui existent entre les différentes espèces.

A vous de jouer

Voici la séquence en acides aminés du collagène de différentes espèces.

>Brachylophosaurus canadensis 
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGSAGPPGATGFPGAAGRGETGPAGPAGP 
>Tyranosaurus rex 
GATGAPGIAGAPGFPGARGAPGPQGPSGAPGPKGSAGPPGATGFPGAAGRGVQGPPGPQGP 
>Python bivittatus 
GSTGSPGIAGAPGFPGARGPAGPQGPSGAPGPKGNSGEPGAPGNKGDAGAGEPGPVGVQGP 
>Coturnix japonica (caille japonaise) 
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGNSGEPGAPGNKGDTGAGEPGPAGVQGP 
>Gallus gallus (poulet) 
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGNSGEPGAPGNKGDTGAGEPGPAGVQGP 
>Alligator sinensis 
GATGAPGIAGAPGFPGARGPSGPQGPSGAPGPKGNSGEPGAQGNKGDTGAGVQGPPGPAGE

Chercher le nombre de différences entre la séquence du collagène du Brachylophosaurus canadensis et la séquence du collagène des autres espèces.

Vous pouvez le faire manuellement ou utiliser le programme informatique SIM – Alignment Tool for protein sequences

Remplir le tableau et vérifier vos résultats.

EspèceNombre de différences
Brachylophosaurus canadensis0
Tyranosaurus rex
Python bivittatus
Coturnix japonica (caille japonaise)
Gallus gallus (poulet)
Alligator sinensis

Vérifier

Je donne ma langue au chat !

Activité 2

La démarche de l’activité 1 est un peu fastidieuse et elle n’est pas tout-à-fait finie : certains changements ont biologiquement plus d’impacts que d’autres.

C’est la raison pour laquelle les programmes bioinformatiques qui comparent les séquences utilisent une ‘matrice de substitution’ pour calculer le score d’alignement, comme par exemple la matrice BLOSUM62.

Ces matrices de substitution attribuent une valeur à chaque paire d’acides aminés (par exemple: A-A: 4; G-G: 0; A-R: – 1). L’addition de ces valeurs permet de calculer le score final de l’alignement.

BLOSUM62

De façon générale, la valeur de substitution est basée sur le degré de similitude des deux acides aminés. S’ils sont très similaires (en termes de forme et de propriétés physicochimiques), la paire d’acides aminés recevra un score élevé. Si les acides aminés sont très différents, la paire d’acides aminés recevra un score faible.

Voici le tableau avec les scores calculés à l’aide de la matrice BLOSUM62, en comparant la séquence du collagène du Brachylophosaurus canadensis avec la séquence du collagène des autres espèces.

Pour vérifier ces scores d’alignements 2 à 2, vous pouvez utiliser le programme SIM – Alignment Tool for protein sequences. Selon les programmes et les paramètres choisis, les scores peuvent être différents.

EspèceNombre de différencesScore
Brachylophosaurus canadensis0340
Tyranosaurus rex6304
Python bivittatus15258
Coturnix japonica (caille japonaise)12267
Gallus gallus (poulet)12267
Alligator sinensis13262

A vous de jouer

Qui a un ancêtre commun avec qui ?

Plus les protéines de 2 espèces sont similaires, plus leurs ancêtre commun est récent. En fonction des données présentes dans le tableau ci-dessus (scores), placer les différentes espèces dans l’arbre phylogénétique ci-dessous.

dinopoulet-phylogenetic-tree-activity-2
Brachylophosaurus canadensis
Python bivittatus
Coturnix japonica (Japanese quail)
Alligator sinensis
Gallus gallus (chicken)
Tyranosaurus rex
1
2
3
4
5
6

Ce type de démarche et des analyses statistiques complexes incluant des séquences de collagènes de plus de 30 espèces différentes, a permis d’établir que les dinosaures sont les plus proches parents des oiseaux.

Les dinosaures n’ont donc pas tous disparu : un petit groupe a survécu et parmi eux, les dinosaures ‘aviaires’, les ancêtres de nos oiseaux.

Ces résultats confirment les prédictions faites à partir des comparaisons anatomiques des squelettes. Il s’agit toutefois de la première preuve  moléculaire (génétique) du lien évolutif qui existe entre les oiseaux modernes et les dinosaures.

Print Friendly, PDF & Email

What did you think?

Loading spinner